Synthesis and expression in Escherichia coli of the gene encoding monocyte-derived neutrophil-activating factor: biological equivalence between natural and recombinant neutrophil-activating factor

Proc Natl Acad Sci U S A. 1988 Dec;85(23):9199-203. doi: 10.1073/pnas.85.23.9199.

Abstract

The neutrophil-activating factor (NAF) purified from the conditioned medium of lipopolysaccharide-stimulated human monocytes was sequenced and found to consist of 72 amino acids: SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRA ENS. Purified preparations of natural NAF contained, in addition to this main form, minor amounts of three amino-terminal variants with 77 (+AVLPR), 70, and 69 residues. A gene coding for the 72-amino acid NAF was synthesized, cloned, and expressed in Escherichia coli. Western (immunologic) blot analysis of crude bacterial extracts, with an antiserum raised against natural NAF, revealed a single band that comigrated with natural NAF. Recombinant NAF purified to homogeneity had identical amino- and carboxyl-terminal sequences to the 72-amino acid natural NAF. Recombinant NAF was tested on human neutrophils and had the same activity and potency as natural NAF in inducing chemotaxis, rapidly increasing cytosolic free Ca2+, activating the respiratory burst, and releasing specific and azurophilic granular contents.

Publication types

  • Research Support, Non-U.S. Gov't

MeSH terms

  • Amino Acid Sequence
  • Base Sequence
  • Biological Assay
  • Chemotactic Factors / genetics*
  • Cloning, Molecular
  • Escherichia coli / genetics*
  • Genes*
  • Genes, Synthetic*
  • Humans
  • Interleukin-8
  • Molecular Sequence Data
  • Monocytes / physiology
  • Peptides / genetics*
  • Peptides / physiology
  • Recombinant Proteins / pharmacology

Substances

  • Chemotactic Factors
  • Interleukin-8
  • Peptides
  • Recombinant Proteins

Associated data

  • GENBANK/M23344